PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 678334464
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lentibulariaceae; Utricularia
Family TALE
Protein Properties Length: 674aa    MW: 73112.3 Da    PI: 7.2058
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
678334464genomeUGSPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox28.13.5e-093784151954
                HHH..SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
   Homeobox  19 Fek..nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                Fe   ++yp+ +++  LAk++gLt +qV++WF N R +
  678334464 378 FEHflHPYPKDSDKLMLAKQTGLTRSQVSNWFINARVR 415
                554459******************************88 PP

2BELL116.21.6e-37242313172
       BELL   1 erqelqkkkakLlslleeVdkrYkqyveqlqtvissFeavaglgsakpYtslAlkaiSrhFrcLkdaiaeqi 72 
                erqe+q+kkakL+++l+eVd+rY++y++q+q vis Fe+ ag+gsak+Yt+lAl++iS++FrcLkdai +qi
  678334464 242 ERQEIQMKKAKLVNMLDEVDQRYRHYHHQMQSVISWFEQNAGIGSAKSYTALALQTISKQFRCLKDAILHQI 313
                79********************************************************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005743.7E-59159311IPR006563POX domain
PfamPF075262.9E-48164309IPR006563POX domain
PROSITE profilePS5007112.147356419IPR001356Homeobox domain
SMARTSM003892.3E-9359423IPR001356Homeobox domain
CDDcd000862.09E-12359420No hitNo description
SuperFamilySSF466898.13E-17360426IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.603.0E-28362425IPR009057Homeodomain-like
PfamPF059206.1E-18376415IPR008422Homeobox KN domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009610Biological Processresponse to symbiotic fungus
GO:0009737Biological Processresponse to abscisic acid
GO:0010197Biological Processpolar nucleus fusion
GO:0010201Biological Processresponse to continuous far red light stimulus by the high-irradiance response system
GO:0005634Cellular Componentnucleus
GO:0005737Cellular Componentcytoplasm
GO:0003677Molecular FunctionDNA binding
GO:0042803Molecular Functionprotein homodimerization activity
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 674 aa     Download sequence    Send to blast
MAGYFHGNSE IQSGGDGLQT LILMNPAYAG YSDNQHPAST PTQQQQPGNN FVFLNSAGGD  60
GRSLANAPPS QTQTFAGVPL HGPVSHQEKD ISAPYGFFPY NLYNLQADLA ATRDVTRAQQ  120
GLSLSLSSQQ PHGYGGGGDE LRVSGGSPSS ASAVSNGVTG VQSVLFSSKY LKAAQELLDE  180
VVNVGKGTKN VSESSKTPFS NDVHAKNLGD SSSGATVAAT TGDGPSGGEG SSKRDSDLTT  240
AERQEIQMKK AKLVNMLDEV DQRYRHYHHQ MQSVISWFEQ NAGIGSAKSY TALALQTISK  300
QFRCLKDAIL HQIRTASRTL GEEDNVDGKT EGSRLKYVDN QIRQQRALQQ LGMIQHNAWR  360
PQRGLPERSV SVLRAWLFEH FLHPYPKDSD KLMLAKQTGL TRSQVSNWFI NARVRLWKPM  420
VEEMYTEEMR EQGRNLSDDK NEHNDESTSK SAAAQPKTPV TEKQSNKPSL QESPILRNPS  480
ISTAVTSPMN SFTAFKLIPS SGLESIAQAS PKKLRTAGDV LHSPGSIPAM NLASEPTNED  540
NNSIAREAAF TLLGAPTNFI GGFGSYSIGD LGRFTTEQYP PAAYSGNGVS LTLGLPHSHC  600
ENISIQGAHQ SFIPNQRIQM GGTSEFSLMN SPAPPHSTSL YENLSLQRQK NFSAQLLPEF  660
VARKSITDFA MGME
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3k2a_A5e-16365423563Homeobox protein Meis2
3k2a_B5e-16365423563Homeobox protein Meis2
4xrs_A4e-16365422158Homeobox protein Meis1
4xrs_B4e-16365422158Homeobox protein Meis1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011094236.10.0PREDICTED: BEL1-like homeodomain protein 1
SwissprotQ9SJ561e-151BLH1_ARATH; BEL1-like homeodomain protein 1
TrEMBLA0A068UQ860.0A0A068UQ86_COFCA; Uncharacterized protein
STRINGGLYMA03G36070.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA14782467
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G35940.31e-140BEL1-like homeodomain 1